제품 > 항체 > 단일클론항체(mAb)

CD31/PECAM1 Rabbit mAb (A20228)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using CD31/PECAM1 Rabbit mAb (A20228) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Immunohistochemistry - CD31/PECAM1 Rabbit mAb (A20228)

Immunohistochemistry analysis of paraffin-embedded Human kidney using CD31/PECAM1 Rabbit mAb (A20228) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human tonsil using CD31/PECAM1 Rabbit mAb (A20228) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunoprecipitation - CD31/PECAM1 Rabbit mAb (A20228)

Immunoprecipitation analysis of 300 μg extracts of Jurkat cells using 3 μg CD31/PECAM1 antibody (A20228). Western blot was performed from the immunoprecipitate using CD31/PECAM1 antibody (A20228) at a dilution of 1:1000.

Overview

Product name	CD31/PECAM1 Rabbit mAb
Catalog No.	A20228
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC5013-19

Background

The protein encoded by this gene is found on the surface of platelets, monocytes, neutrophils, and some types of T-cells, and makes up a large portion of endothelial cell intercellular junctions. The encoded protein is a member of the immunoglobulin superfamily and is likely involved in leukocyte migration, angiogenesis, and integrin activation.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 630-738 of CD31/PECAM1 (NP_000433.4).
Sequence	AKQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT
Gene ID
Swiss Prot
Synonyms	CD31; PECA1; GPIIA'; PECAM-1; endoCAM; CD31/EndoCAM; CD31/PECAM1
Calculated MW	83KDa
Observed MW	130-140kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	THP-1, Jurkat
Cellular location	Cell junction, Cell junction, Cell membrane, Lipid-anchor, Single-pass type I membrane protein.
Customer validation	IHC(Homo sapiens)