Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Mitofusin 2 Rabbit mAb |
---|---|
Catalog No. | A19678 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0157 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Mitofusin 2 (O95140). |
---|---|
Sequence | MSLLFSRCNSIVTVKKNKRHMAEVNASPLKHFVTAKKKINGIFEQLGAYIQESATFLEDTYRNAELDPVTTEEQVLDVKGYLSKVRGISEVLARRHMKVA |
Gene ID | |
Swiss Prot | |
Synonyms | HSG; MARF; CMT2A; CPRP1; CMT2A2; HMSN6A; CMT2A2A; CMT2A2B; Mitofusin 2 |
Calculated MW | 86kDa |
Observed MW | 80kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | Raji, MCF7, 293T, NIH/3T3, Mouse brain, Rat heart, Rat brain |
Cellular location | Mitochondrion outer membrane, Multi-pass membrane protein. |
Customer validation | WB(Rattus norvegicus, Mus musculus, Homo sapiens, Sus scrofa, Rattus norvegicus, Gallus gallus) IHC(Mus musculus, Rattus norvegicus) IF(Mus musculus, Rattus norvegicus) IF(Gallus gallus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19678? Please let us know so that we can cite the reference in this datasheet.