제품 > 항체 > 단일클론항체(mAb)

CD5 Rabbit mAb (A25910)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 Human PBMC were surface-stained with CD5 Rabbit mAb (A25910, 2 μg/mL, orange line) or Rabbit IgG isotype control (AC042, 2 μg/mL, blue line), followed by ABflo® 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line)

Flow cytometry: 1X10^6 K-562 cells (negative control, left) and MOLT-4 cells (right) were surface-stained with CD5 Rabbit mAb (A25910, 2 μg/mL, orange line) or Rabbit IgG isotype control (AC042, 2 μg/mL, blue line), followed by ABflo® 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 MOLT-4 cells were surface-stained with Rabbit IgG isotype control (AC042, 2 μg/mL, left) or CD5 Rabbit mAb (A25910, 2 μg/mL, right), followed by ABflo® 647 conjugated goat anti-rabbit pAb staining.

Flow cytometry: 1X10^6 Human PBMC were surface-stained with Rabbit IgG isotype control (AC042, 2 μg/mL, left) or CD5 Rabbit mAb (A25910, 2 μg/mL, right), followed by ABflo® 647 conjugated goat anti-rabbit pAb staining.

Overview

Product name	CD5 Rabbit mAb
Catalog No.	A25910
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC53917

Background

This gene encodes a member of the scavenger receptor cysteine-rich (SRCR) superfamily. Members of this family are secreted or membrane-anchored proteins mainly found in cells associated with the immune system. This protein is a type-I transmembrane glycoprotein found on the surface of thymocytes, T lymphocytes and a subset of B lymphocytes. The encoded protein contains three SRCR domains and may act as a receptor to regulate T-cell proliferation. Alternative splicing results in multiple transcript variants encoding different isoforms.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 25-371 of human CD5 (NP_055022.2).
Sequence	RLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPN
Gene ID
Swiss Prot
Synonyms	T1; LEU1
Calculated MW	55kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	External side of plasma membrane, Plasma membrane