Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | CD98/SLC3A2 Rabbit mAb |
---|---|
Catalog No. | A23191 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC59441 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 461-630 of human SLC3A2/CD98hc. (NP_002385.3). |
---|---|
Sequence | PGTPVFSYGDEIGLDAAALPGQPMEAPVMLWDESSFPDIPGAVSANMTVKGQSEDPGSLLSLFRRLSDQRSKERSLLHGDFHAFSAGPGLFSYIRHWDQNERFLVVLNFGDVGLSAGLQASDLPASASLPAKADLLLSTQPGREEGSPLELERLKLEPHEGLLLRFPYAA |
Gene ID | |
Swiss Prot | |
Synonyms | 4F2; CD98; MDU1; 4F2HC; 4T2HC; NACAE; CD98HC; CD98/SLC3A2 |
Calculated MW | 58kDa |
Observed MW | 75-120kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | HepG2, HeLa |
Cellular location | anchoring junction, apical plasma membrane, basal plasma membrane, basolateral plasma membrane, extracellular exosome, nucleoplasm, plasma membrane |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.