제품 > 항체 > 단일클론항체(mAb)

CDC16 Rabbit mAb (A3583)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from NIH/3T3 cells, using CDC16 Rabbit mAb (A3583) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - CDC16 Rabbit mAb (A3583)

Immunohistochemistry analysis of paraffin-embedded rat ovary using CDC16 Rabbit mAb (A3583) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human colon using CDC16 Rabbit mAb (A3583) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse spinal cord using CDC16 Rabbit mAb (A3583) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - CDC16 Rabbit mAb (A3583)

Immunofluorescence analysis of C6 cells using CDC16 Rabbit mAb (A3583) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U-2 OS cells using CDC16 Rabbit mAb (A3583) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	CDC16 Rabbit mAb
Catalog No.	A3583
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2053

Background

The protein encoded by this gene functions as a protein ubiquitin ligase and is a component of the multiprotein APC complex. The APC complex is a cyclin degradation system that governs exit from mitosis by targeting cell cycle proteins for degredation by the 26S proteasome. Each component protein of the APC complex is highly conserved among eukaryotic organisms. This protein, and other APC complex proteins, contain a tetratricopeptide repeat (TPR) domain; a protein domain that is often involved in protein-protein interactions and the assembly of multiprotein complexes. Multiple alternatively spliced transcript variants, encoding distinct proteins, have been identified.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CDC16 (Q13042).
Sequence	LLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPV
Gene ID
Swiss Prot
Synonyms	APC6; CUT9; ANAPC6; CDC16Hs; CDC16
Calculated MW	72kDa
Observed MW	72kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	NIH/3T3
Cellular location	Cytoplasm, centrosome, cytoskeleton, microtubule organizing center, spindle