제품 > 항체 > 다중클론항체(pAb)

CDC20 Rabbit pAb (A15656)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from PC-3 cells, using CDC20 Rabbit pAb (A15656) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - CDC20 Rabbit pAb (A15656)

Immunohistochemistry analysis of paraffin-embedded Rat ovary using CDC20 Rabbit pAb (A15656) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Rat spleen using CDC20 Rabbit pAb (A15656) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer using CDC20 Rabbit pAb (A15656) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunoprecipitation - CDC20 Rabbit pAb (A15656)

Immunoprecipitation analysis of 200 μg extracts of LO2 cells using 3 μg CDC20 antibody (A15656). Western blot was performed from the immunoprecipitate using CDC20 antibody (A15656) at a dilution of 1:1000.

Overview

Product name	CDC20 Rabbit pAb
Catalog No.	A15656
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

CDC20 appears to act as a regulatory protein interacting with several other proteins at multiple points in the cell cycle. It is required for two microtubule-dependent processes, nuclear movement prior to anaphase and chromosome separation.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CDC20 (NP_001246.2?).
Sequence	MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQ
Gene ID
Swiss Prot
Synonyms	CDC20A; OOMD14; p55CDC; OZEMA14; bA276H19.3; CDC20
Calculated MW	55kDa
Observed MW	55kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:100 IF/ICC 1:50 - 1:100 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	PC-3
Cellular location	Cytoplasm, centrosome, cytoskeleton, microtubule organizing center, spindle pole
Customer validation	WB(Homo sapiens, Mus musculus, Mus musculus) IF(Homo sapiens, Mus musculus) IHC(Mus musculus)