제품 > 항체 > 단일클론항체(mAb)

CDC5L Rabbit mAb (A9527)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using CDC5L Rabbit mAb (A9527) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - CDC5L Rabbit mAb (A9527)

Immunohistochemistry analysis of paraffin-embedded Human colon using CDC5L Rabbit mAb (A9527) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Overview

Product name	CDC5L Rabbit mAb
Catalog No.	A9527
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1618

Background

The protein encoded by this gene shares a significant similarity with Schizosaccharomyces pombe cdc5 gene product, which is a cell cycle regulator important for G2/M transition. This protein has been demonstrated to act as a positive regulator of cell cycle G2/M progression. It was also found to be an essential component of a non-snRNA spliceosome, which contains at least five additional protein factors and is required for the second catalytic step of pre-mRNA splicing.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 300-400 of human CDC5L (Q99459).
Sequence	PQISDAELQEVVKVGQASEIARQTAEESGITNSASSTLLSEYNVTNNSVALRTPRTPASQDRILQEAQNLMALTNVDTPLKGGLNTPLHESDFSGVTPQRQ
Gene ID
Swiss Prot
Synonyms	CDC5; CEF1; PCDC5RP; CDC5-LIKE; dJ319D22.1; CDC5L
Calculated MW	92kDa
Observed MW	100kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HeLa, 293T, SH-SY5Y, Mouse testis, Mouse brain, Mouse thymus
Cellular location	Cytoplasm, Nucleus, Nucleus speckle