CDK16 Rabbit pAb (A8140)

Datasheet

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

ABclonal:Immunofluorescence - CDK16 Rabbit pAb (A8140)

Immunofluorescence analysis of U2OS cells using CDK16 antibody (A8140) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	CDK16 Rabbit pAb
Catalog No.	A8140
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

The protein encoded by this gene belongs to the cdc2/cdkx subfamily of the ser/thr family of protein kinases. It may play a role in signal transduction cascades in terminally differentiated cells; in exocytosis; and in transport of secretory cargo from the endoplasmic reticulum. This gene is thought to escape X inactivation. Alternative splicing results in multiple transcript variants encoding different isoforms.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 277-496 of human CDK16 (NP_006192.1).
Sequence	CHRQKVLHRDLKPQNLLINERGELKLADFGLARAKSIPTKTYSNEVVTLWYRPPDILLGSTDYSTQIDMWGVGCIFYEMATGRPLFPGSTVEEQLHFIFRILGTPTEETWPGILSNEEFKTYNYPKYRAEALLSHAPRLDSDGADLLTKLLQFEGRNRISAEDAMKHPFFLSLGERIHKLPDTTSIFALKEIQLQKEASLRSSSMPDSGRPAFRVVDTEF
Gene ID
Swiss Prot
Synonyms	PCTK1; PCTAIRE; PCTAIRE1; PCTGAIRE
Calculated MW	56kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Immunofluorescence
Positive samples
Cellular location	Cell junction, Cell membrane, Cytoplasm, Cytoplasmic side, Cytoplasmic vesicle, Peripheral membrane protein, secretory vesicle, synapse, synaptosome