제품 > 항체 > 다중클론항체(pAb)

CEACAM4 Rabbit pAb (A10055)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of extracts of various cell lines, using CEACAM4 antibody (A10055) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 20s.

Overview

Product name	CEACAM4 Rabbit pAb
Catalog No.	A10055
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Involved in phagocytosis. Predicted to be located in extracellular region.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 36-155 of human CEACAM4 (NP_001808.2).
Sequence	FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHVHQNNVPGLPVGAVAG
Gene ID
Swiss Prot
Synonyms	NCA; CGM7; CGM7_HUMAN
Calculated MW	26kDa
Observed MW	24kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	U-87MG, A-549
Cellular location	Membrane, Single-pass type I membrane protein
Customer validation	WB(Homo sapiens)