제품 > 항체 > 단일클론항체(mAb)

CEACAM6 Rabbit mAb (A5971)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using CEACAM6 Rabbit mAb (A5971) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - CEACAM6 Rabbit mAb (A5971)

Immunofluorescence analysis of rat rectum cells using CEACAM6 Rabbit mAb (A5971) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of human colon carcinoma cells using CEACAM6 Rabbit mAb (A5971) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of mouse large intestine cells using CEACAM6 Rabbit mAb (A5971) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	CEACAM6 Rabbit mAb
Catalog No.	A5971
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2110

Background

This gene encodes a protein that belongs to the carcinoembryonic antigen (CEA) family whose members are glycosyl phosphatidyl inositol (GPI) anchored cell surface glycoproteins. Members of this family play a role in cell adhesion and are widely used as tumor markers in serum immunoassay determinations of carcinoma. This gene affects the sensitivity of tumor cells to adenovirus infection. The protein encoded by this gene acts as a receptor for adherent-invasive E. coli adhesion to the surface of ileal epithelial cells in patients with Crohn's disease. This gene is clustered with genes and pseudogenes of the cell adhesion molecules subgroup of the CEA family on chromosome 19.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CEACAM6 (P40199).
Sequence	LTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQ
Gene ID
Swiss Prot
Synonyms	NCA; CEAL; CD66c
Calculated MW	37kDa
Observed MW	37kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	A-549, Mouse liver
Cellular location	apical plasma membrane, cell surface, extracellular space, plasma membrane
Customer validation	IF(Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CEACAM6 Rabbit mAb images

Western blot - CEACAM6 Rabbit mAb (A5971)

Immunofluorescence - CEACAM6 Rabbit mAb (A5971)

Immunofluorescence analysis of rat rectum cells using CEACAM6 Rabbit mAb (A5971) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence - CEACAM6 Rabbit mAb (A5971)

Immunofluorescence analysis of human colon carcinoma cells using CEACAM6 Rabbit mAb (A5971) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence - CEACAM6 Rabbit mAb (A5971)

Immunofluorescence analysis of mouse large intestine cells using CEACAM6 Rabbit mAb (A5971) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.