제품 > 항체 > 다중클론항체(pAb)

CIAPIN1 Rabbit pAb (A6336)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using CIAPIN1 Rabbit pAb (A6336) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - CIAPIN1 Rabbit pAb (A6336)

Immunofluorescence analysis of U2OS cells using CIAPIN1 Rabbit pAb (A6336). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - CIAPIN1 Rabbit pAb (A6336)

Immunoprecipitation analysis of 200 μg extracts of 293T cells, using 3 μg CIAPIN1 antibody (A6336). Western blot was performed from the immunoprecipitate using CIAPIN1 antibody (A6336) at a dilution of 1:1000.

Overview

Product name	CIAPIN1 Rabbit pAb
Catalog No.	A6336
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

CIAPIN1 is a cytokine-induced inhibitor of apoptosis with no relation to apoptosis regulatory molecules of the BCL2 (MIM 151430) or CASP (see MIM 147678) families. Expression of CIAPIN1 is dependent on growth factor stimulation (Shibayama et al., 2004 [PubMed 14970183]).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-312 of human CIAPIN1 (NP_064709.2).
Sequence	MADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEVQSVREHLGHESDNLLFVQITGKKPNFEVGSSRQLKLSITKKSSPSVKPAVDPAAAKLWTLSANDMEDDSMDLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA
Gene ID
Swiss Prot
Synonyms	DRE2; CIAE2; PRO0915; Anamorsin; CIAPIN1
Calculated MW	34kDa
Observed MW	39kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	SKOV3, 293T, HepG2, HeLa, MCF-7, Mouse testis
Cellular location	Cytoplasm, Mitochondrion, Mitochondrion intermembrane space, Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CIAPIN1 Rabbit pAb images

Western blot - CIAPIN1 Rabbit pAb (A6336)

Immunofluorescence - CIAPIN1 Rabbit pAb (A6336)

Immunofluorescence analysis of U2OS cells using CIAPIN1 Rabbit pAb (A6336). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunoprecipitation - CIAPIN1 Rabbit pAb (A6336)

* For research use only. Not for therapeutic or diagnostic purposes.