Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | CLDN2 Rabbit pAb |
---|---|
Catalog No. | A14085 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 184-230 of human CLDN2 (NP_001164563.1). |
---|---|
Sequence | SCSSQRNRSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV |
Gene ID | |
Swiss Prot | |
Synonyms | OAZON; claudin-2; CLDN2 |
Calculated MW | 25kDa |
Observed MW | 25kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | A-549, Rat liver |
Cellular location | Cell junction, Cell membrane, Multi-pass membrane protein, tight junction. |
Customer validation | WB(Rattus norvegicus, Homo sapiens, Anatinae, Horabagrus nigricollaris) IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A14085? Please let us know so that we can cite the reference in this datasheet.