제품 > 항체 > 다중클론항체(pAb)

COLGALT1 Rabbit pAb (A16571)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of Mouse ovary, using COLGALT1 antibody (A16571) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - COLGALT1 Rabbit pAb (A16571)

Immunofluorescence analysis of HeLa cells using COLGALT1 Rabbit pAb (A16571) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH/3T3 cells using COLGALT1 Rabbit pAb (A16571) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of PC-12 cells using COLGALT1 Rabbit pAb (A16571) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of SH-SY5Y cells using COLGALT1 Rabbit pAb (A16571) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	COLGALT1 Rabbit pAb
Catalog No.	A16571
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is one of two enzymes that transfers galactose moieties to hydroxylysine residues of collagen and mannose binding lectin. This gene is constitutively expressed and encodes a soluble protein that localizes to the endoplasmic reticulum.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 30-230 of human COLGALT1 (NP_078932.2).
Sequence	APPGADAYFPEERWSPESPLQAPRVLIALLARNAAHALPTTLGALERLRHPRERTALWVATDHNMDNTSTVLREWLVAVKSLYHSVEWRPAEEPRSYPDEEGPKHWSDSRYEHVMKLRQAALKSARDMWADYILFVDADNLILNPDTLSLLIAENKTVVAPMLDSRAAYSNFWCGMTSQGYYKRTPAYIPIRKRDRRGCFA
Gene ID
Swiss Prot
Synonyms	BSVD3; GLT25D1; ColGalT 1
Calculated MW	72kDa
Observed MW	72kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Mouse ovary
Cellular location	Endoplasmic reticulum lumen