제품 > 항체 > 다중클론항체(pAb)

COMP Rabbit pAb (A13963)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using COMP antibody (A13963) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - COMP Rabbit pAb (A13963)

Immunofluorescence analysis of L929 cells using COMP Rabbit pAb (A13963) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	COMP Rabbit pAb
Catalog No.	A13963
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is a noncollagenous extracellular matrix (ECM) protein. It consists of five identical glycoprotein subunits, each with EGF-like and calcium-binding (thrombospondin-like) domains. Oligomerization results from formation of a five-stranded coiled coil and disulfides. Binding to other ECM proteins such as collagen appears to depend on divalent cations. Contraction or expansion of a 5 aa aspartate repeat and other mutations can cause pseudochondroplasia (PSACH) and multiple epiphyseal dysplasia (MED).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 20-160 of human COMP (NP_000086.2).
Sequence	GQGQSPLGSDLGPQMLRELQETNAALQDVRELLRQQVREITFLKNTVMECDACGMQQSVRTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTGNGSHCTDVNECNAHPCFPRVRCINTSPGFRCEACPPGYSG
Gene ID
Swiss Prot
Synonyms	MED; CTS2; EDM1; EPD1; TSP5; PSACH; THBS5; TSP-5
Calculated MW	83kDa
Observed MW	105kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	SKOV3, LO2, U-87MG, HL-60, Mouse skeletal muscle, Rat testis
Cellular location	Secreted, extracellular matrix, extracellular space
Customer validation	WB(Mus musculus, Gallus gallus) IHC(Homo sapiens) IHC(Gallus gallus) IF(Gallus gallus)