제품 > 항체 > 다중클론항체(pAb)

CPSF3L Rabbit pAb (A6566)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using CPSF3L Rabbit pAb (A6566) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - CPSF3L Rabbit pAb (A6566)

Immunofluorescence analysis of HeLa cells using CPSF3L Rabbit pAb (A6566). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - CPSF3L Rabbit pAb (A6566)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg CPSF3L antibody (A6566). Western blot was performed from the immunoprecipitate using CPSF3L antibody (A6566) at a dilution of 1:500.

Overview

Product name	CPSF3L Rabbit pAb
Catalog No.	A6566
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The Integrator complex contains at least 12 subunits and associates with the C-terminal domain of RNA polymerase II large subunit (POLR2A; MIM 180660) and mediates the 3-prime end processing of small nuclear RNAs U1 (RNU1; MIM 180680) and U2 (RNU2; MIM 180690). INTS11, or CPSF3L, is the catalytic subunit of the Integrator complex (Baillat et al., 2005 [PubMed 16239144]).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 331-600 of human CPSF3L (NP_060341.2).
Sequence	GQSLQIFRKWAGNEKNMVIMPGYCVQGTVGHKILSGQRKLEMEGRQVLEVKMQVEYMSFSAHADAKGIMQLVGQAEPESVLLVHGEAKKMEFLKQKIEQELRVNCYMPANGETVTLPTSPSIPVGISLGLLKREMAQGLLPEAKKPRLLHGTLIMKDSNFRLVSSEQALKELGLAEHQLRFTCRVHLHDTRKEQETALRVYSHLKSVLKDHCVQHLPDGSVTVESVLLQAAAPSEDPGTKVLLVSWTYQDEELGSFLTSLLKKGLPQAPS
Gene ID
Swiss Prot
Synonyms	RC68; INT11; RC-68; CPSF3L; CPSF73L
Calculated MW	68kDa
Observed MW	68kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:10 - 1:100 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	HeLa, SKOV3, MCF7, Mouse spleen, Rat liver
Cellular location	Cytoplasm, Nucleus
Customer validation	WB(Mus musculus) FC(Homo sapiens) WB(Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CPSF3L Rabbit pAb images

Western blot - CPSF3L Rabbit pAb (A6566)

Immunofluorescence - CPSF3L Rabbit pAb (A6566)

Immunofluorescence analysis of HeLa cells using CPSF3L Rabbit pAb (A6566). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunoprecipitation - CPSF3L Rabbit pAb (A6566)

* For research use only. Not for therapeutic or diagnostic purposes.