제품 > 항체 > 다중클론항체(pAb)

CPSF6 Rabbit pAb (A5963)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using CPSF6 Rabbit pAb (A5963) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - CPSF6 Rabbit pAb (A5963)

Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer using CPSF6 Rabbit pAb (A5963) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer using CPSF6 Rabbit pAb (A5963) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Mouse lung using CPSF6 Rabbit pAb (A5963) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Rat testis using CPSF6 Rabbit pAb (A5963) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - CPSF6 Rabbit pAb (A5963)

Confocal immunofluorescence analysis of U2OS cells using CPSF6 Rabbit pAb (A5963) at dilution of 1:100. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - CPSF6 Rabbit pAb (A5963)

Immunoprecipitation analysis of 300 μg extracts of 293T cells using 3 μg CPSF6 antibody (A5963). Western blot was performed from the immunoprecipitate using CPSF6 antibody (A5963) at a dilution of 1:1000.

Overview

Product name	CPSF6 Rabbit pAb
Catalog No.	A5963
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors. The cleavage factor complex is composed of four polypeptides. This gene encodes the 68kD subunit. It has a domain organization reminiscent of spliceosomal proteins.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-330 of human CPSF6 (NP_008938.2).
Sequence	MADGVDHIDIYADVGEEFNQEAEYGGHDQIDLYDDVISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELHGQNPVVTPCNKQFLSQFEMQSRKTTQSGQMSGEGKAGPPGGSSRAAFPQGGRGRGRFPGAVPGGDRFPGPAGPGGPPPPFPAGQTPPRPPLGPPGPPGPPGPPPPGQVLPPPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQGPPPPPGPFPPRPPGP
Gene ID
Swiss Prot
Synonyms	CFIM; CFIM68; CFIM72; HPBRII-4; HPBRII-7; CPSF6
Calculated MW	59kDa
Observed MW	68kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:3000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	HeLa, 293T, Jurkat, HepG2, HT-1080, Mouse brain, Mouse liver, Rat brain
Cellular location	Nucleus
Customer validation	FC(Homo sapiens) WB(Homo sapiens)