Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | CRYAA Rabbit mAb |
---|---|
Catalog No. | A5111 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC1245 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 6-95 of human CRYAA (P02489). |
---|---|
Sequence | QHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVE |
Gene ID | |
Swiss Prot | |
Synonyms | CRYA1; HSPB4; CTRCT9 |
Calculated MW | 20kDa |
Observed MW | 18kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | Mouse eye, Rat eye |
Cellular location | Cytoplasm, Nucleus |
Customer validation | WB(Rattus norvegicus, Mus musculus) IF(Mus musculus) IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A5111? Please let us know so that we can cite the reference in this datasheet.