제품 > 항체 > 단일클론항체(mAb)

CTBP2 Rabbit mAb (A0463)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using CTBP2 Rabbit mAb (A0463) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - CTBP2 Rabbit mAb (A0463)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using CTBP2 Rabbit mAb (A0463) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse kidney using CTBP2 Rabbit mAb (A0463) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded rat ovary using CTBP2 Rabbit mAb (A0463) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - CTBP2 Rabbit mAb (A0463)

Immunofluorescence analysis of NIH/3T3 cells using CTBP2 Rabbit mAb (A0463) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of PC-12 cells using CTBP2 Rabbit mAb (A0463) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U2OS cells using CTBP2 Rabbit mAb (A0463) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - CTBP2 Rabbit mAb (A0463)

Immunoprecipitation analysis of 300 μg extracts of Hela cells using 3 μg CTBP2 antibody (A0463). Western blot was performed from the immunoprecipitate using CTBP2 (A0463) at a dilution of 1:1000.

Overview

Product name	CTBP2 Rabbit mAb
Catalog No.	A0463
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2509

Background

This gene produces alternative transcripts encoding two distinct proteins. One protein is a transcriptional repressor, while the other isoform is a major component of specialized synapses known as synaptic ribbons. Both proteins contain a NAD+ binding domain similar to NAD+-dependent 2-hydroxyacid dehydrogenases. A portion of the 3' untranslated region was used to map this gene to chromosome 21q21.3; however, it was noted that similar loci elsewhere in the genome are likely. Blast analysis shows that this gene is present on chromosome 10. Several transcript variants encoding two different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 346-445 of human CTBP2 (P56545).
Sequence	TGRIPESLRNCVNKEFFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVAPGGLPAAMEGIIPGGIPVTHNLPTVAHPSQAPSPNQPTKHGDNREHPNEQ
Gene ID
Swiss Prot
Synonyms	CTBP2; C-terminal-binding protein 2
Calculated MW	49kDa
Observed MW	47kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	HeLa, NIH/3T3, Rat testis
Cellular location	Cell junction, Nucleus, synapse

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CTBP2 Rabbit mAb images

Western blot - CTBP2 Rabbit mAb (A0463)

Immunohistochemistry - CTBP2 Rabbit mAb (A0463)

Immunofluorescence - CTBP2 Rabbit mAb (A0463)

Immunoprecipitation - CTBP2 Rabbit mAb (A0463)

Immunoprecipitation analysis of 300 μg extracts of Hela cells using 3 μg CTBP2 antibody (A0463). Western blot was performed from the immunoprecipitate using CTBP2 (A0463) at a dilution of 1:1000.

* For research use only. Not for therapeutic or diagnostic purposes.