제품 > 항체 > 다중클론항체(pAb)

CYBA Rabbit pAb (A10694)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of RAW264.7, using CYBA antibody (A10694) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Western blot analysis of Rat lung, using CYBA antibody (A10694) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunofluorescence - CYBA Rabbit pAb (A10694)

Immunofluorescence analysis of MCF7 cells using CYBA Rabbit pAb (A10694) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH/3T3 cells using CYBA Rabbit pAb (A10694) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of PC-12 cells using CYBA Rabbit pAb (A10694) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	CYBA Rabbit pAb
Catalog No.	A10694
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Cytochrome b is comprised of a light chain (alpha) and a heavy chain (beta). This gene encodes the light, alpha subunit which has been proposed as a primary component of the microbicidal oxidase system of phagocytes. Mutations in this gene are associated with autosomal recessive chronic granulomatous disease (CGD), that is characterized by the failure of activated phagocytes to generate superoxide, which is important for the microbicidal activity of these cells.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 126-195 of human CYBA (NP_000092.2).
Sequence	VRGEQWTPIEPKPRERPQIGGTIKQPPSNPPPRPPAEARKKPSEEEAAVAAGGPPGGPQVNPIPVTDEVV
Gene ID
Swiss Prot
Synonyms	CGD4; p22-PHOX
Calculated MW	21kDa
Observed MW	22kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	RAW264.7, Rat lung
Cellular location	Cell membrane
Customer validation	WB(Homo sapiens, Mus musculus) IF(Mus musculus)