Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | CaMK2 delta/CAMK2 gamma Rabbit mAb |
---|---|
Catalog No. | A0186 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC53334 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CaMK2 delta/CAMK2 gamma (Q13554). |
---|---|
Sequence | CGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKL |
Gene ID | |
Swiss Prot | |
Synonyms | CAM2; CAMK2; CAMKB; MRD54; CaMKIIbeta; CaMK2 delta/CAMK2 gamma |
Calculated MW | 73kDa |
Observed MW | 50kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunoprecipitation |
Positive samples | HeLa, 293T |
Cellular location | cytoplasm, cytosol, microtubule organizing center, nucleoplasm. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.