제품 > 항체 > 단일클론항체(mAb)

Chromogranin A Rabbit mAb (A9576)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Chromogranin A Rabbit mAb (A9576) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Immunohistochemistry - Chromogranin A Rabbit mAb (A9576)

Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using Chromogranin A Rabbit mAb (A9576) at a dilution of 1:4000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human colon tissue using Chromogranin A Rabbit mAb (A9576) at a dilution of 1:4000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human pheochromocytoma tissue using Chromogranin A Rabbit mAb (A9576) at a dilution of 1:4000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using Chromogranin A Rabbit mAb (A9576) at a dilution of 1:4000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using Chromogranin A Rabbit mAb (A9576) at a dilution of 1:4000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - Chromogranin A Rabbit mAb (A9576)

Confocal imaging of Human pancreas using Chromogranin A Rabbit mAb (A9576, dilution 1:100)(Red). DAPI was used for nuclear staining (blue). Objective: 40x.

Overview

Product name	Chromogranin A Rabbit mAb
Catalog No.	A9576
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1643

Background

The protein encoded by this gene is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. It is found in secretory vesicles of neurons and endocrine cells. This gene product is a precursor to three biologically active peptides; vasostatin, pancreastatin, and parastatin. These peptides act as autocrine or paracrine negative modulators of the neuroendocrine system. Two other peptides, catestatin and chromofungin, have antimicrobial activity and antifungal activity, respectively. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Chromogranin A (P10645).
Sequence	MRSAAVLALLLCAGQVTALPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGF
Gene ID
Swiss Prot
Synonyms	CGA; PHE5; PHES; Chromogranin A
Calculated MW	51kDa
Observed MW	80kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:1000 - 1:5000 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	PC-12 cells, SH-SY5Y cells
Cellular location	chromaffin granule, extracellular region, extracellular space, perinuclear region of cytoplasm.
Customer validation	IHC(Mus musculus, Homo sapiens) WB(Mus musculus) IF(Homo sapiens) IHC(Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Chromogranin A Rabbit mAb images

Western blot - Chromogranin A Rabbit mAb (A9576)

Immunohistochemistry - Chromogranin A Rabbit mAb (A9576)

Immunofluorescence - Chromogranin A Rabbit mAb (A9576)

Confocal imaging of Human pancreas using Chromogranin A Rabbit mAb (A9576, dilution 1:100)(Red). DAPI was used for nuclear staining (blue). Objective: 40x.

* For research use only. Not for therapeutic or diagnostic purposes.