Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Chromogranin A Rabbit mAb |
---|---|
Catalog No. | A9576 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC1643 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Chromogranin A (P10645). |
---|---|
Sequence | MRSAAVLALLLCAGQVTALPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGF |
Gene ID | |
Swiss Prot | |
Synonyms | CGA; PHE5; PHES; Chromogranin A |
Calculated MW | 51kDa |
Observed MW | 80kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | PC-12 cells, SH-SY5Y cells |
Cellular location | chromaffin granule, extracellular region, extracellular space, perinuclear region of cytoplasm. |
Customer validation | IHC(Mus musculus, Homo sapiens) WB(Mus musculus) IF(Homo sapiens, Mus musculus) IHC(Homo sapiens, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A9576? Please let us know so that we can cite the reference in this datasheet.