제품 > 항체 > 단일클론항체(mAb)

Citrate synthetase Rabbit mAb (A4569)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from rat heart , using Citrate synthetase Rabbit mAb (A4569) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - Citrate synthetase Rabbit mAb (A4569)

Immunohistochemistry analysis of Citrate synthetase in paraffin-embedded rat liver tissue using Citrate synthetase Rabbit mAb (A4569) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Citrate synthetase in paraffin-embedded rat colon tissue using Citrate synthetase Rabbit mAb (A4569) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Citrate synthetase in paraffin-embedded human colon carcinoma tissue using Citrate synthetase Rabbit mAb (A4569) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Citrate synthetase in paraffin-embedded mouse kidney tissue using Citrate synthetase Rabbit mAb (A4569) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - Citrate synthetase Rabbit mAb (A4569)

Immunofluorescence analysis of NIH/3T3 cells using Citrate synthetase Rabbit mAb (A4569) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	Citrate synthetase Rabbit mAb
Catalog No.	A4569
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1036

Background

The protein encoded by this gene is a Krebs tricarboxylic acid cycle enzyme that catalyzes the synthesis of citrate from oxaloacetate and acetyl coenzyme A. The enzyme is found in nearly all cells capable of oxidative metablism. This protein is nuclear encoded and transported into the mitochondrial matrix, where the mature form is found.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 367-466 of human Citrate synthetase (O75390).
Sequence	HLPNDPMFKLVAQLYKIVPNVLLEQGKAKNPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTEGLMKFVDSKSG
Gene ID
Swiss Prot
Synonyms	CS; Citrate synthetase
Calculated MW	52kDa
Observed MW	45kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Rat heart
Cellular location	Extracellular exosome, mitochondrial matrix, mitochondrion, nucleus
Customer validation	WB(Mus musculus)