Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | Cleaved Caspase-7 Rabbit mAb |
---|---|
Catalog No. | A23154 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC58776 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CASP7 (NP_001218.1). |
---|---|
Sequence | CFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSG |
Gene ID | |
Swiss Prot | |
Synonyms | MCH3; CMH-1; LICE2; CASP-7; ICE-LAP3; Cleaved Caspase-7 |
Calculated MW | 34kDa |
Observed MW | 22kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Jurkat treated by Etoposide |
Cellular location | Cytoplasm. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.