Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse
Product name | Cleaved PARP (Asp214) Rabbit pAb |
---|---|
Catalog No. | A22535 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 201-300 of Mouse PARP (Asp214) (NP_031441.2). |
---|---|
Sequence | AIKNEGKRKGDEVDGTDEVAKKKSKKGKDKDSSKLEKALKAQNELIWNIKDELKKACSTNDLKELLIFNQQQVPSGESAILDRVADGMAFGALLPCKECS |
Gene ID | |
Swiss Prot | |
Synonyms | PARP; PPOL; ARTD1; Adprp; Adprt1; msPARP; parp-1; sPARP-1; 5830444G22Rik; Cleaved PARP (Asp214) |
Calculated MW | 113kDa |
Observed MW | 89kDa |
Reactivity | Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | NIH/3T3 treated by staurosporine |
Cellular location | cytosol, mitochondrion, nuclear body, nuclear envelope, nuclear replication fork, nucleolus |
Customer validation | WB(Mus musculus, Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A22535? Please let us know so that we can cite the reference in this datasheet.