Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Rat
Product name | Collagen IV Rabbit mAb |
---|---|
Catalog No. | A25131 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC65620 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1555-1669 of human COL4A3 (NP_000082.2). |
---|---|
Sequence | AIAIAVHSQTTDIPPCPHGWISLWKGFSFIMFTSAGSEGTGQALASPGSCLEEFRASPFLECHGRGTCNYYSNSYSFWLASLNPERMFRKPIPSTVKAGELEKIISRCQVCMKKR |
Gene ID | |
Swiss Prot | |
Synonyms | ATS2; ATS3; BFH2; COL4A3/COL4A5/COL4A2/COL4A1 |
Calculated MW | 162kDa |
Observed MW | 160-200kDa |
Reactivity | Human, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | HeLa, U266 |
Cellular location | Secreted, basement membrane, extracellular matrix, extracellular space |
Customer validation | IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A25131? Please let us know so that we can cite the reference in this datasheet.