Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Cyclin B2 Rabbit mAb |
---|---|
Catalog No. | A7956 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC1435 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cyclin B2 (O95067). |
---|---|
Sequence | MALLRRPTVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPVQPTKTTNVNKQLKPTASVKPVQMEKLAPKGPSPTPEDVSM |
Gene ID | |
Swiss Prot | |
Synonyms | HsT17299; Cyclin B2 |
Calculated MW | 45kDa |
Observed MW | 45kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | Rat testis |
Cellular location | centrosome, cytoplasm, cytosol, microtubule cytoskeleton, nucleus |
Customer validation | WB(Homo sapiens) IF(Mus musculus,Sus scrofa) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A7956? Please let us know so that we can cite the reference in this datasheet.