제품 > 항체 > 다중클론항체(pAb)

Cytokeratin 13 (KRT13) Rabbit pAb (A16393)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from A-431 cells, using Cytokeratin 13 (Cytokeratin 13 (KRT13)) Rabbit pAb (A16393) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - Cytokeratin 13 (KRT13) Rabbit pAb (A16393)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using Cytokeratin 13 (KRT13) Rabbit pAb (A16393) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human breast cancer using Cytokeratin 13 (KRT13) Rabbit pAb (A16393) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human stomach using Cytokeratin 13 (KRT13) Rabbit pAb (A16393) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Cytokeratin 13 (KRT13) Rabbit pAb (A16393)

Immunofluorescence analysis of paraffin-embedded human placenta using Cytokeratin 13 (KRT13) Rabbit pAb (A16393) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	Cytokeratin 13 (KRT13) Rabbit pAb
Catalog No.	A16393
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. This type I cytokeratin is paired with keratin 4 and expressed in the suprabasal layers of non-cornified stratified epithelia. Mutations in this gene and keratin 4 have been associated with the autosomal dominant disorder White Sponge Nevus. The type I cytokeratins are clustered in a region of chromosome 17q21.2. Alternative splicing of this gene results in multiple transcript variants; however, not all variants have been described.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 269-458 of human Cytokeratin 13 (Cytokeratin 13 (KRT13)) (NP_705694.2).
Sequence	DLTRVLAEMREQYEAMAERNRRDAEEWFHAKSAELNKEVSTNTAMIQTSKTEITELRRTLQGLEIELQSQLSMKAGLENTVAETECRYALQLQQIQGLISSIEAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMIGFPSSAGSVSPRSTSVTTTSSASVTTTSNASGRRTSDVRRP
Gene ID
Swiss Prot
Synonyms	K13; CK13; WSN2; Cytokeratin 13 (KRT13)
Calculated MW	50kDa
Observed MW	50kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:100 IF/ICC 1:50 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	A-431
Cellular location	cytoskeleton, cytosol, extracellular exosome, intermediate filament cytoskeleton, nucleus