제품 > 항체 > 단일클론항체(mAb)

Cytokeratin 14 (KRT14) Rabbit mAb (A19039)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from SK-OV-3 cells, using Cytokeratin 14 (KRT14) Rabbit mAb (A19039) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

ABclonal:Immunohistochemistry - Cytokeratin 14 (KRT14) Rabbit mAb (A19039)

Immunohistochemistry analysis of paraffin-embedded Human cervical squamous cell carcinoma using Cytokeratin 14 (KRT14) Rabbit mAb (A19039) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human lung squamous carcinoma tissue using Cytokeratin 14 (KRT14) Rabbit mAb (A19039) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human tonsil using Cytokeratin 14 (KRT14) Rabbit mAb (A19039) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat brain using Cytokeratin 14 (KRT14) Rabbit mAb (A19039) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Overview

Product name	Cytokeratin 14 (KRT14) Rabbit mAb
Catalog No.	A19039
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0351

Background

This gene encodes a member of the keratin family, the most diverse group of intermediate filaments. This gene product, a type I keratin, is usually found as a heterotetramer with two keratin 5 molecules, a type II keratin. Together they form the cytoskeleton of epithelial cells. Mutations in the genes for these keratins are associated with epidermolysis bullosa simplex. At least one pseudogene has been identified at 17p12-p11.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 264-457 of human Cytokeratin 14 (KRT14) (P02533).
Sequence	VGGDVNVEMDAAPGVDLSRILNEMRDQYEKMAEKNRKDAEEWFFTKTEELNREVATNSELVQSGKSEISELRRTMQNLEIELQSQLSMKASLENSLEETKGRYCMQLAQIQEMIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHD
Gene ID
Swiss Prot
Synonyms	K14; NFJ; CK14; EBS1; EBS3; EBS4; EBS1A; EBS1B; EBS1C; EBS1D; Cytokeratin 14 (KRT14)
Calculated MW	52kDa
Observed MW	53kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IHC-P 1:200 - 1:800 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	SK-OV-3
Cellular location	Cytoplasm, Nucleus.
Customer validation	IF(Mus musculus) WB(Rattus norvegicus, Homo sapiens) IF(Homo sapiens) IHC(Mus musculus)