제품 > 항체 > 단일클론항체(mAb)

Cytokeratin 2e (KRT2) Rabbit mAb (A2615)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from A-431 cells, using Cytokeratin 2e (KRT2) Rabbit mAb (A2615) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - Cytokeratin 2e (KRT2) Rabbit mAb (A2615)

Immunohistochemistry analysis of paraffin-embedded Mouse skin using Cytokeratin 2e (KRT2) Rabbit mAb (A2615) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunofluorescence - Cytokeratin 2e (KRT2) Rabbit mAb (A2615)

Immunofluorescence analysis of paraffin-embedded rat skin using Cytokeratin 2e (KRT2) Rabbit mAb (A2615) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of paraffin-embedded human skin using Cytokeratin 2e (KRT2) Rabbit mAb (A2615) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of paraffin-embedded mouse skin using Cytokeratin 2e (KRT2) Rabbit mAb (A2615) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Confocal imaging of paraffin-embedded Human tonsil tissue using Cytokeratin 2e (KRT2) Rabbit mAb (A2615, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Overview

Product name	Cytokeratin 2e (KRT2) Rabbit mAb
Catalog No.	A2615
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1925

Background

The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is expressed largely in the upper spinous layer of epidermal keratinocytes and mutations in this gene have been associated with bullous congenital ichthyosiform erythroderma. The type II cytokeratins are clustered in a region of chromosome 12q12-q13.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 293-422 of humanKRT2(P35908).
Sequence	YMIKVELQSKVDLLNQEIEFLKVLYDAEISQIHQSVTDTNVILSMDNSRNLDLDSIIAEVKAQYEEIAQRSKEEAEALYHSKYEELQVTVGRHGDSLKEIKIEISELNRVIQRLQGEIAHVKKQCKNVQD
Gene ID
Swiss Prot
Synonyms	K2e; KRTE; CK-2e; KRT2A; KRT2E; Cytokeratin 2e (KRT2)
Calculated MW	65kDa
Observed MW	65kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	A-431
Cellular location	cytoplasm, cytosol, extracellular exosome, extracellular space, nucleus.