DAB2IP Rabbit pAb (A20493)

Datasheet

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

ABclonal:Immunofluorescence - DAB2IP Rabbit pAb (A20493)

Immunofluorescence analysis of PC-12 cells using DAB2IP Rabbit pAb (A20493) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	DAB2IP Rabbit pAb
Catalog No.	A20493
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

DAB2IP is a Ras (MIM 190020) GTPase-activating protein (GAP) that acts as a tumor suppressor. The DAB2IP gene is inactivated by methylation in prostate and breast cancers (Yano et al., 2005 [PubMed 15386433]).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 205-320 of human DAB2IP (NP_619723.1).
Sequence	RIKARYQTITILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKA
Gene ID
Swiss Prot
Synonyms	AIP1; AIP-1; AF9Q34; DIP1/2
Calculated MW	132kDa
Observed MW	Refer to Figures

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples
Cellular location	axon, cerebellar mossy fiber, climbing fiber, cytoplasm, cytosol, dendrite, parallel fiber, plasma membrane