제품 > 항체 > 다중클론항체(pAb)

DAG1 Rabbit pAb (A10076)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from Mouse heart, using DAG1 Rabbit pAb (A10076) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunofluorescence - DAG1 Rabbit pAb (A10076)

Immunofluorescence analysis of HeLa cells using DAG1 Rabbit pAb(A10076) at a dilution of 1:200 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - DAG1 Rabbit pAb (A10076)

Immunoprecipitation analysis of 300 μg extracts of Hela cells using 3 μg DAG1 antibody (A10076). Western blot was performed from the immunoprecipitate using DAG1 antibody (A10076) at a dilution of 1:1000.

Overview

Product name	DAG1 Rabbit pAb
Catalog No.	A10076
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes dystroglycan, a central component of dystrophin-glycoprotein complex that links the extracellular matrix and the cytoskeleton in the skeletal muscle. The encoded preproprotein undergoes O- and N-glycosylation, and proteolytic processing to generate alpha and beta subunits. Certain mutations in this gene are known to cause distinct forms of muscular dystrophy. Alternative splicing results in multiple transcript variants, all encoding the same protein.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 776-895 of human DAG1 (NP_001171108.1).
Sequence	RKKRKGKLTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSVPETTPLNQDTMGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
Gene ID
Swiss Prot
Synonyms	A3a; DAG; AGRNR; 156DAG; MDDGA9; MDDGC7; MDDGC9; LGMDR16; DAG1
Calculated MW	97kDa
Observed MW	43kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IF/ICC 1:20 - 1:100 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	Mouse heart
Cellular location	Cell junction, Cell membrane, Cytoplasm, Nucleus, Secreted, Single-pass type I membrane protein, cytoskeleton, extracellular space, nucleoplasm, postsynaptic cell membrane, sarcolemma, synapse.
Customer validation	IF(Homo sapiens) WB(Capra hircus, Mus musculus)