제품 > 항체 > 다중클론항체(pAb)

DCAF12 Rabbit pAb (A16510)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Western blot analysis of various lysates using DCAF12 Rabbit pAb (A16510) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Overview

Product name	DCAF12 Rabbit pAb
Catalog No.	A16510
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a WD repeat-containing protein that interacts with the COP9 signalosome, a macromolecular complex that interacts with cullin-RING E3 ligases and regulates their activity by hydrolyzing cullin-Nedd8 conjugates.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human DCAF12 (NP_056212.1).
Sequence	MARKVVSRKRKAPASPGAGSDAQGPQFGWDHSLHKRKRLPPVKRSLVYYLKNREVRLQNETSYSRVLHGYAAQQLPSLLKEREFH
Gene ID
Swiss Prot
Synonyms	CT102; TCC52; WDR40A; KIAA1892; DCAF12
Calculated MW	51kDa
Observed MW	47kDa

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HepG2, Rat kidney
Cellular location	Cytoplasm, centrosome, cytoskeleton, microtubule organizing center