Review (1)Publications (9) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | DLST Rabbit pAb |
---|---|
Catalog No. | A13297 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human DLST (NP_001924.2). |
---|---|
Sequence | PAKAKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPLAEPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTT |
Gene ID | |
Swiss Prot | |
Synonyms | DLTS; KGD2; PGL7; DLST |
Calculated MW | 49kDa |
Observed MW | 49kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | Mouse liver, Mouse kidney, Rat kidney, Rat liver |
Cellular location | Mitochondrion. |
Customer validation | (mouse heart cells) WB(Gallus gallus, Mus musculus, Oryctolagus cuniculus, Sus scrofa, Homo sapiens) IHC(Homo sapiens) ChIP(Homo sapiens) WB(Homo sapiens) IP(Sus scrofa) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A13297? Please let us know so that we can cite the reference in this datasheet.