제품 > 항체 > 단일클론항체(mAb)

DMT1/SLC11A2 Rabbit mAb (A23379)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from 293F cells, using DMT1/SLC11A2 Rabbit mAb (A23379) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunofluorescence - DMT1/SLC11A2 Rabbit mAb (A23379)

Immunofluorescence analysis of 293T cells using DMT1/SLC11A2 Rabbit mAb (A23379) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - DMT1/SLC11A2 Rabbit mAb (A23379)

Immunoprecipitation analysis of 300 μg extracts of 293F cells using 3 μg DMT1/SLC11A2 Rabbit mAb (A23379). Western blot was performed from the immunoprecipitate using DMT1/SLC11A2 Rabbit mAb antibody (A23379) at a dilition of 1:1000.

Overview

Product name	DMT1/SLC11A2 Rabbit mAb
Catalog No.	A23379
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC59972

Background

This gene encodes a member of the solute carrier family 11 protein family. The product of this gene transports divalent metals and is involved in iron absorption. Mutations in this gene are associated with hypochromic microcytic anemia with iron overload. A related solute carrier family 11 protein gene is located on chromosome 2. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 300-400 of human DMT1/SLC11A2 (NP_000608.1)
Sequence	SCIALFVSFIINVFVVSVFAEAFFGKTNEQVVEVCTNTSSPHAGLFPKDNSTLAVDIYKGGVVLGCYFGPAALYIWAVGILAAGQSSTMTGTYSGQFVMEG
Gene ID
Swiss Prot
Synonyms	DCT1; DMT1; AHMIO1; NRAMP2; DMT1/SLC11A2
Calculated MW	61KDa/62KDa/64KDa/65KDa
Observed MW	55-100kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	293F
Cellular location	Cell membrane, Early endosome, Endosome membrane, Mitochondrion outer membrane, Multi-pass membrane protein.
Customer validation	WB(Homo sapiens)