제품 > 항체 > 단일클론항체(mAb)

DNA Polymerase beta Rabbit mAb (A2412)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using DNA Polymerase beta Rabbit mAb (A2412) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunohistochemistry - DNA Polymerase beta Rabbit mAb (A2412)

Immunohistochemistry analysis of paraffin-embedded Rat testis using DNA Polymerase beta Rabbit mAb (A2412) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse testis using DNA Polymerase beta Rabbit mAb (A2412) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Overview

Product name	DNA Polymerase beta Rabbit mAb
Catalog No.	A2412
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0752

Background

The protein encoded by this gene is a DNA polymerase involved in base excision and repair, also called gap-filling DNA synthesis. The encoded protein, acting as a monomer, is normally found in the cytoplasm, but it translocates to the nucleus upon DNA damage. Several transcript variants of this gene exist, but the full-length nature of only one has been described to date.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 236-335 of human DNA Polymerase beta (P06746).
Sequence	MGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Gene ID
Swiss Prot
Synonyms	POLB; DNA polymerase beta; DNA Polymerase beta
Calculated MW	38kDa
Observed MW	42kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 IHC-P 1:200 - 1:800 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HeLa, A-431, Jurkat, Mouse testis, Mouse spleen, Mouse thymus, Rat testis, Rat spleen
Cellular location	Cytoplasm, Nucleus.