제품 > 항체 > 다중클론항체(pAb)

DYNLRB1 Rabbit pAb (A15197)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using DYNLRB1 Rabbit pAb (A15197) at 1:700 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - DYNLRB1 Rabbit pAb (A15197)

Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer using DYNLRB1 Rabbit pAb (A15197) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Overview

Product name	DYNLRB1 Rabbit pAb
Catalog No.	A15197
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene is a member of the roadblock dynein light chain family. The encoded cytoplasmic protein is capable of binding intermediate chain proteins, interacts with transforming growth factor-beta, and has been implicated in the regulation of actin modulating proteins. Upregulation of this gene has been associated with hepatocellular carcinomas, suggesting that this gene may be involved in tumor progression. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene have been defined on chromosomes 12 and 18.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-63 of human DYNLRB1 (NP_001268656.1).
Sequence	MDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE
Gene ID
Swiss Prot
Synonyms	BLP; BITH; DNCL2A; DNLC2A; ROBLD1; DYNLRB1
Calculated MW	11kDa
Observed MW	11kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	U-87MG, Mouse brain
Cellular location	Cytoplasm, cytoskeleton
Customer validation	WB(Homo sapiens) IF(Homo sapiens)