Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Western blot analysis of various lysates using EAAT1/SLC1A3 Rabbit mAb (A9712) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.
Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using EAAT1/SLC1A3 Rabbit mAb (A9712) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using EAAT1/SLC1A3 Rabbit mAb (A9712) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Confocal imaging of paraffin-embedded Rat brain tissue using EAAT1/SLC1A3 Rabbit mAb (A9712, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
Confocal imaging of paraffin-embedded Mouse brain tissue using EAAT1/SLC1A3 Rabbit mAb (A9712, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
| Product name | EAAT1/SLC1A3 Rabbit mAb |
|---|---|
| Catalog No. | A9712 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC1714 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human EAAT1/SLC1A3 (P43003). |
|---|---|
| Sequence | GTKENMHREGKIVRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPGSVNGVNALGLVVFS |
| Gene ID | |
| Swiss Prot | |
| Synonyms | EA6; EAAT1; GLAST; GLAST1; EAAT1/SLC1A3 |
| Calculated MW | 60kDa |
| Observed MW | 50-55kDa/90-130kDa |
| Reactivity | Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | Mouse brain, Rat brain |
| Cellular location | Membrane, Multi-pass membrane protein. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
