제품 > 항체 > 다중클론항체(pAb)

EGLN1/EGLN2 Rabbit pAb (A10342)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of extracts of various cell lines, using EGLN1/EGLN2 antibody (A10342) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	EGLN1/EGLN2 Rabbit pAb
Catalog No.	A10342
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The proteins encoded by EGLN1/EGLN2 gene catalyzes the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. HIF is a transcriptional complex that plays a central role in mammalian oxygen homeostasis. This protein functions as a cellular oxygen sensor, and under normal oxygen concentration, modification by prolyl hydroxylation is a key regulatory event that targets HIF subunits for proteasomal destruction via the von Hippel-Lindau ubiquitylation complex.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 250-350 of human EGLN1/EGLN2 (NP_071334.1/NP_444274.1).
Sequence	DIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGK
Gene ID
Swiss Prot
Synonyms	EGLN1/EGLN2
Calculated MW	36kDa/43kDa/46kDa/40kDa
Observed MW	44kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HL-60, 293T
Cellular location	cytoplasm, cytosol, glutamatergic synapse, nucleus, postsynaptic density