Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | ENTPD4 Rabbit pAb |
---|---|
Catalog No. | A16469 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 350-470 of human ENTPD4 (NP_001122402.1). |
---|---|
Sequence | LTPDMPYLDPCLPLDIKDEIQQNGQTIYLRGTGDFDLCRETIQPFMNKTNETQTSLNGVYQPPIHFQNSEFYGFSEFYYCTEDVLRMGGDYNAAKFTKAAKDYCATKWSILRERFDRGLYA |
Gene ID | |
Swiss Prot | |
Synonyms | LAP70; LALP70; LYSAL1; UDPase; NTPDase-4; ENTPD4 |
Calculated MW | 70kDa |
Observed MW | 80kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Jurkat, Mouse heart, Rat testis |
Cellular location | Cytoplasmic vesicle, Golgi apparatus membrane, Multi-pass membrane protein, autophagosome membrane |
* For research use only. Not for therapeutic or diagnostic purposes.