제품 > 항체 > 다중클론항체(pAb)

EPB41 Rabbit pAb (A25049)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using EPB41 Rabbit pAb (A25049) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunoprecipitation - EPB41 Rabbit pAb (A25049)

Immunoprecipitation of EPB41 in 300 µg extracts from K-562 cells using 3 µg EPB41 Rabbit pAb (A25049). Western blot analysis was performed using EPB41 Rabbit pAb (A25049) at 1:500 dilution.

Overview

Product name	EPB41 Rabbit pAb
Catalog No.	A25049
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene, together with spectrin and actin, constitute the red cell membrane cytoskeletal network. This complex plays a critical role in erythrocyte shape and deformability. Mutations in this gene are associated with type 1 elliptocytosis (EL1). Alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 700-800 of human EPB41(NP_001159477.1).
Sequence	RPSEWDKRLSTHSPFRTLNINGQIPTGEGPPLVKTQTVTISDNANAVKSEIPTKDVPIVHTETKTITYEAAQTDDNSGDLDPGVLLTAQTITSETPSSTTT
Gene ID
Swiss Prot
Synonyms	HE; EL1; 4.1R
Calculated MW	97kDa
Observed MW	81kDa/60-135kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	K-562, , HEL
Cellular location	Cytoplasm, Nucleus, cell cortex, cytoskeleton

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

연구세포 생물학 & 발달 생물학세포 골격미세섬유

EPB41 Rabbit pAb images

Western blot - EPB41 Rabbit pAb (A25049)

Immunoprecipitation - EPB41 Rabbit pAb (A25049)

Immunoprecipitation of EPB41 in 300 µg extracts from K-562 cells using 3 µg EPB41 Rabbit pAb (A25049). Western blot analysis was performed using EPB41 Rabbit pAb (A25049) at 1:500 dilution.

* For research use only. Not for therapeutic or diagnostic purposes.