제품 > 항체 > 다중클론항체(pAb)

ESE1/ELF3 Rabbit pAb (A13489)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates, using ESE1/ELF3 Rabbit pAb (A13489) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.

ABclonal:Immunoprecipitation - ESE1/ELF3 Rabbit pAb (A13489)

Immunoprecipitation analysis of 150 μg extracts of A549 cells using 3 μg ESE1/ESE1/ELF3 antibody (A13489). Western blot was performed from the immunoprecipitate using ESE1/ESE1/ELF3 antibody (A13489) at a dilution of 1:500.____Detection: ECL Enhanced Kit (RM00021)._Exposure time: 30s.

Overview

Product name	ESE1/ELF3 Rabbit pAb
Catalog No.	A13489
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables DNA-binding transcription activator activity, RNA polymerase II-specific and sequence-specific double-stranded DNA binding activity. Involved in inflammatory response; negative regulation of transcription, DNA-templated; and positive regulation of transcription by RNA polymerase II. Located in Golgi apparatus; cytosol; and nucleoplasm.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human ESE1/ESE1/ELF3 (NP_004424.3).
Sequence	MAATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGADDLVLTLSNPQMSLEGTEKASWLGEQPQFWSKTQVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQLHAQLRDLTSSSSDELSWIIELLEKDGMAFQEALDPGPFDQGSPFAQELLDDGQQASPYHPGSCGAGAPSPGSSDVSTAGTGASRSSHSSDSGGSDVDLDPTDGKLFPSDGFRDCKKGDPKHGKRKRGRPRKLSKEYWDCLEGKKSKHAPRGTHLWEFIR
Gene ID
Swiss Prot
Synonyms	ERT; ESX; EPR-1; ESE-1; ESE1/ELF3
Calculated MW	41kDa
Observed MW	47kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:100 - 1:500 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	A-431, SK-BR-3
Cellular location	Cytoplasm, Nucleus
Customer validation	ChIP(Homo sapiens, Mus musculus) WB(Arabidopsis thaliana)