Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | ETS1 Rabbit mAb |
---|---|
Catalog No. | A19603 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0082 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ETS1 (P14921). |
---|---|
Sequence | MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCM |
Gene ID | |
Swiss Prot | |
Synonyms | p54; ETS-1; EWSR2; c-ets-1; ETS1 |
Calculated MW | 50kDa |
Observed MW | 46kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | A549, Jurkat, Raji, MCF7 |
Cellular location | Cytoplasm, Nucleus. |
Customer validation | ChIP(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19603? Please let us know so that we can cite the reference in this datasheet.