제품 > 항체 > 단일클론항체(mAb)

ETS1 Rabbit mAb (A19603)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using ETS1 Rabbit mAb (A19603) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1min.

Overview

Product name	ETS1 Rabbit mAb
Catalog No.	A19603
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0082

Background

This gene encodes a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. These proteins function either as transcriptional activators or repressors of numerous genes, and are involved in stem cell development, cell senescence and death, and tumorigenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ETS1 (P14921).
Sequence	MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCM
Gene ID
Swiss Prot
Synonyms	p54; ETS-1; EWSR2; c-ets-1; ETS1
Calculated MW	50kDa
Observed MW	46kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	A549, Jurkat, Raji, MCF7
Cellular location	Cytoplasm, Nucleus.
Customer validation	ChIP(Mus musculus)