제품 > 항체 > 다중클론항체(pAb)

Epn2 Rabbit pAb (A16623)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from HepG2 cells, using Epn2 Rabbit pAb (A16623) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	Epn2 Rabbit pAb
Catalog No.	A16623
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable clathrin binding activity and phospholipid binding activity. Acts upstream of or within Notch signaling pathway; embryonic organ development; and in utero embryonic development. Predicted to be located in intracellular membrane-bounded organelle. Predicted to be part of clathrin coat of endocytic vesicle. Predicted to be active in endosome and plasma membrane. Orthologous to human EPN2 (epsin 2).

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-200 of mouse Epn2 (XP_006532226.1).
Sequence	IFAIQTLKDFQYIDRDGKDQGINVREKSKQLVALLKDEERLKVERVQALKTKERMAQVATGVGSNQITFGRGSSQPNLSTSYSEQEYGKAGGSPASYHGSP
Gene ID
Swiss Prot
Synonyms	Ibp2; 9530051D10Rik; Epn2
Calculated MW	68kDa
Observed MW	68kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HepG2
Cellular location	cytosol, endosome, plasma membrane