Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Western blot analysis of various lysates using FABP4 Rabbit mAb (A11481) at 1：1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
| Product name | FABP4 Rabbit mAb |
|---|---|
| Catalog No. | A11481 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC0616 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FABP4 (P15090). |
|---|---|
| Sequence | MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKNTEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDG |
| Gene ID | |
| Swiss Prot | |
| Synonyms | aP2; ALBP; AFABP; A-FABP; HEL-S-104; FABP4 |
| Calculated MW | 15kDa |
| Observed MW | 15kDa |
| Reactivity | Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | Mouse heart, Mouse thymus, Rat heart, Rat thymus |
| Cellular location | Cytoplasm, Nucleus. |
| Customer validation | WB(Sus scrofa, Mus musculus, Oryctolagus cuniculus, Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A11481? Please let us know so that we can cite the reference in this datasheet.
