Reviews (2)Publications (10) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | FADD Rabbit pAb |
---|---|
Catalog No. | A5819 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-208 of human FADD (NP_003815.1). |
---|---|
Sequence | MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS |
Gene ID | |
Swiss Prot | |
Synonyms | GIG3; IMD90; MORT1; FADD |
Calculated MW | 23kDa |
Observed MW | 26kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunoprecipitation |
Positive samples | 293T, MCF7, HeLa, Mouse liver, Mouse kidney, Mouse heart |
Cellular location | cytoplasm, cytosol, neuron projection, nucleus, plasma membrane, ripoptosome. |
Customer validation | (Human fibrosarcoma cells, Eoma cell) WB(Mus musculus, Gallus gallus, Homo sapiens, Ctenopharyngodon idellus, Cyprinus carpio, Bos taurus) IHC(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A5819? Please let us know so that we can cite the reference in this datasheet.