제품 > 항체 > 단일클론항체(mAb)

FBP1 Rabbit mAb (A11664)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from MCF7 cells, using FBP1 Rabbit mAb (A11664) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunofluorescence - FBP1 Rabbit mAb (A11664)

Immunofluorescence analysis of HeLa cells using FBP1 Rabbit mAb (A11664) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of paraffin-embedded rat kidney using FBP1 Rabbit mAb (A11664) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of paraffin-embedded mouse kidney using FBP1 Rabbit mAb (A11664) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	FBP1 Rabbit mAb
Catalog No.	A11664
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0664

Background

Fructose-1, 6-bisphosphatase 1, a gluconeogenesis regulatory enzyme, catalyzes the hydrolysis of fructose 1, 6-bisphosphate to fructose 6-phosphate and inorganic phosphate. Fructose-1, 6-diphosphatase deficiency is associated with hypoglycemia and metabolic acidosis.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 239-338 of human FBP1 (P09467).
Sequence	APYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHSAQ
Gene ID
Swiss Prot
Synonyms	FBP; FBP1
Calculated MW	37kDa
Observed MW	40kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 IF/ICC 1:100 - 1:400 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	MCF7
Cellular location	cytoplasm, cytosol, extracellular exosome, nucleus.
Customer validation	WB(Mus musculus)