제품 > 항체 > 다중클론항체(pAb)

FFAR4 Rabbit pAb (A18689)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using FFAR4 Rabbit pAb (A18689) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Overview

Product name	FFAR4 Rabbit pAb
Catalog No.	A18689
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a G protein-coupled receptor (GPR) which belongs to the rhodopsin family of GPRs. The encoded protein functions as a receptor for free fatty acids, including omega-3, and participates in suppressing anti-inflammatory responses and insulin sensitizing. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 333-377 of human FFAR4 (NP_859529.2).
Sequence	NPILYNMTLCRNEWKKIFCCFWFPEKGAILTDTSVKRNDLSIISG
Gene ID
Swiss Prot
Synonyms	GT01; PGR4; OB10Q; BMIQ10; GPR120; GPR129; O3FAR1; FFAR4
Calculated MW	40kDa
Observed MW	42kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HT-29, BxPC-3, RAW264.7, Mouse large intestine, Rat large intestine, Rat small intestine
Cellular location	ciliary membrane, cilium, plasma membrane