Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | FGFR3 Rabbit mAb |
---|---|
Catalog No. | A19052 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0398 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FGFR3 (P22607). |
---|---|
Sequence | MGAPACALALCVAVAIVAGASSESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNAS |
Gene ID | |
Swiss Prot | |
Synonyms | ACH; CEK2; JTK4; CD333; HSFGFR3EX; FGFR3 |
Calculated MW | 88kDa |
Observed MW | 110kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | 293T, Mouse brain, Mouse lung, Rat lung, Rat kidney |
Cellular location | Cell membrane, Cytoplasmic vesicle, Endoplasmic reticulum, Secreted, Single-pass type I membrane protein. |
Customer validation | WB(Rattus norvegicus, Homo sapiens, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19052? Please let us know so that we can cite the reference in this datasheet.