제품 > 항체 > 다중클론항체(pAb)

FKBP38/FKBP8 Rabbit pAb (A7085)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using FKBP38/FKBP8 Rabbit pAb (A7085) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunofluorescence - FKBP38/FKBP8 Rabbit pAb (A7085)

Immunofluorescence analysis of A549 cells using FKBP38/FKBP8 Rabbit pAb (A7085). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - FKBP38/FKBP8 Rabbit pAb (A7085)

Immunoprecipitation analysis of 200 μg extracts of HeLa cells using 1 μg FKBP38/FKBP38/FKBP8 antibody (A7085). Western blot was performed from the immunoprecipitate using FKBP38/FKBP38/FKBP8 antibody (A7085) at a dilution of 1:1000.

Overview

Product name	FKBP38/FKBP8 Rabbit pAb
Catalog No.	A7085
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. Unlike the other members of the family, this encoded protein does not seem to have PPIase/rotamase activity. It may have a role in neurons associated with memory function.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 60-270 of human FKBP38/FKBP38/FKBP8 (NP_036313.3).
Sequence	QPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSSAKVDMTFEEEAQLLQ
Gene ID
Swiss Prot
Synonyms	FKBP38; FKBPr38; FKBP38/FKBP8
Calculated MW	45kDa
Observed MW	55kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:100 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	Jurkat, THP-1, BT-474, HeLa, HL-60, Mouse liver, Mouse brain, Mouse eye, Rat brain
Cellular location	Cytoplasmic side, Mitochondrion membrane, Single-pass membrane protein
Customer validation	WB(Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

연구신경 과학칼슘 신호전달

FKBP38/FKBP8 Rabbit pAb images

Western blot - FKBP38/FKBP8 Rabbit pAb (A7085)

Immunofluorescence - FKBP38/FKBP8 Rabbit pAb (A7085)

Immunofluorescence analysis of A549 cells using FKBP38/FKBP8 Rabbit pAb (A7085). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunoprecipitation - FKBP38/FKBP8 Rabbit pAb (A7085)

* For research use only. Not for therapeutic or diagnostic purposes.