제품 > 항체 > 다중클론항체(pAb)

FLI1 Rabbit pAb (A5644)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using (A5644) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunoprecipitation - FLI1 Rabbit pAb (A5644)

Immunoprecipitation analysis of 200 μg extracts of Jurkat cells using 1 μg FLI1 antibody (A5644). Western blot was performed from the immunoprecipitate using FLI1 antibody (A5644) at a dilution of 1:1000.

Overview

Product name	FLI1 Rabbit pAb
Catalog No.	A5644
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a transcription factor containing an ETS DNA-binding domain. The gene can undergo a t(11;22)(q24;q12) translocation with the Ewing sarcoma gene on chromosome 22, which results in a fusion gene that is present in the majority of Ewing sarcoma cases. An acute lymphoblastic leukemia-associated t(4;11)(q21;q23) translocation involving this gene has also been identified. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human FLI1 (NP_002008.2).
Sequence	MDGTIKEALSVVSDDQSLFDSAYGAAAHLPKADMTASGSPDYGQPHKINPLPPQQEWINQPVRVNVKREYDHMNGSRESPVDCSVSKCSKLVGGGESNPM
Gene ID
Swiss Prot
Synonyms	EWSR2; FLI-1; SIC-1; BDPLT21; FLI1
Calculated MW	51kDa
Observed MW	51kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	Jurkat, Mouse lung
Cellular location	Nucleus
Customer validation	WB(Mus musculus) ChIP(Homo sapiens)